PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01011415001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family ZF-HD
Protein Properties Length: 90aa    MW: 9671.73 Da    PI: 8.2229
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01011415001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer101.17.5e-322682360
        ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60
                       +vrY eC+kNhAa +Gg+avDGC+Efm+s geegt++al+CaACgCHRnFH reve+e
  GSVIVT01011415001 26 SVRYGECQKNHAAGVGGYAVDGCREFMAS-GEEGTSSALTCAACGCHRNFHLREVETE 82
                       79**************************9.999********************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257743.0E-28184IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047705.1E-302779IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015664.7E-262879IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152325.7842978IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 90 aa     Download sequence    Send to blast
MRKRQVVLRR DEPSRSSANS SFTVRSVRYG ECQKNHAAGV GGYAVDGCRE FMASGEEGTS  60
SALTCAACGC HRNFHLREVE TESIIGTSN*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Vvi.10291e-134fruit| inflorescence| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4829561e-133AM482956.1 Vitis vinifera, whole genome shotgun sequence, contig VV78X096604.7, clone ENTAV 115.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010661067.14e-54PREDICTED: mini zinc finger protein 2-like
SwissprotQ9LJW57e-38MIF2_ARATH; Mini zinc finger protein 2
TrEMBLF6H5T54e-54F6H5T5_VITVI; Putative uncharacterized protein
STRINGVIT_14s0108g00810.t011e-53(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9116237
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28917.14e-39mini zinc finger 2